PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa12g014370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 463aa    MW: 51636.8 Da    PI: 9.0361
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa12g014370.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B336.86.9e-1222921287
                    HTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3 12 ksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87
                    ++++ ++p +f+++h + k+ s++l+l++  s r+Wev+l  ++++    +++GWk+F   + ++e D++ F++d+ 
  Csa12g014370.1 22 QNSNPIIPSQFIANHIKGKTLSTKLKLTSvASDRTWEVEL--DGGR----FAAGWKDFSVFHAVREDDVLSFRHDEY 92
                    455589*********5566899*******8888*******..9998....99*********************8765 PP

2B367.91.4e-21103192697
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     +++++l ++ l+l  kfa+++g++k+e  ++ l+de+g+sW++ l+++kk g+ ++++GW++F++ ng k+g  + Fk+++ s++++v++++
  Csa12g014370.1 103 VTPSSLLRDTLCLLSKFARSNGLDKREC-EIDLMDEHGKSWTLLLRHNKKTGQAFMRGGWRKFCRNNGFKSGSLCRFKVVQ-SGTKPVLQLC 192
                     5677778888*************99775.*************************************************988.8999999988 PP

3B339.88e-13241331699
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--.TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLk.egDfvvFkldgrsefelvvkvfrk 99 
                     ++++vl+s+++++p   a+++g+ k++  ++t+ +++g++W+  l   k++++++++ G keF  ang+k +gD +++++++  ++++ +k+++k
  Csa12g014370.1 241 LKPYVLRSSQFRVPALLARDNGILKAG--EVTVLNKDGEEWKSHLVNVKGRDQFYIR-GCKEFFVANGIKnVGDPFTLEVVR-GGTSPILKICSK 331
                     5799*****************999877..7***************888899999999.************9********887.88889****987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.8E-10791IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-9891IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508637.741191IPR003340B3 DNA binding domain
SMARTSM010199.3E-51497IPR003340B3 DNA binding domain
CDDcd100171.99E-82791No hitNo description
Gene3DG3DSA:2.40.330.106.0E-2095192IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.26E-1998192IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.92998195IPR003340B3 DNA binding domain
SMARTSM010191.2E-2598195IPR003340B3 DNA binding domain
PfamPF023624.9E-20102192IPR003340B3 DNA binding domain
CDDcd100179.50E-19103193No hitNo description
SuperFamilySSF1019367.26E-9234330IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.5E-8234331IPR015300DNA-binding pseudobarrel domain
CDDcd100171.50E-8235330No hitNo description
PROSITE profilePS508637.458236332IPR003340B3 DNA binding domain
SMARTSM010191.4E-16236332IPR003340B3 DNA binding domain
PfamPF023621.7E-12240331IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MADPLSSSSN KKAFFVVDLS GQNSNPIIPS QFIANHIKGK TLSTKLKLTS VASDRTWEVE  60
LDGGRFAAGW KDFSVFHAVR EDDVLSFRHD EYISEDSYLL AHVTPSSLLR DTLCLLSKFA  120
RSNGLDKREC EIDLMDEHGK SWTLLLRHNK KTGQAFMRGG WRKFCRNNGF KSGSLCRFKV  180
VQSGTKPVLQ LCPITSTIPE GNSSKANKKG NVSECEGDEI ETEDCSETVP VLQNKILTLD  240
LKPYVLRSSQ FRVPALLARD NGILKAGEVT VLNKDGEEWK SHLVNVKGRD QFYIRGCKEF  300
FVANGIKNVG DPFTLEVVRG GTSPILKICS KVKQVSFDGH KTLERKPRMT VPAPHAEDET  360
ENRVQKKARV CTEEGPSRCT RASNKSSTDP GNLQRKQPLQ PCSISDHVKK VRQSIVDTLT  420
DVRRFRSELE IKEQNLQASL HEIDALGEKI MGISQIFNIS QA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL0310041e-120AL031004.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F28M20 (ESSAII project).
GenBankAL1615791e-120AL161579.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 75.
GenBankCP0026871e-120CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010447523.10.0PREDICTED: putative B3 domain-containing protein REM4 isoform X1
SwissprotQ9SB790.0REM4_ARATH; Putative B3 domain-containing protein REM4
TrEMBLR0GW330.0R0GW33_9BRAS; Uncharacterized protein
STRINGAT4G31630.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96581537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31630.10.0B3 family protein